JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
FREE Shipping for orders over $200
For this product you will need: BACTERIOSTATIC WATER For reconstitution.
Sermorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). It binds with GHRH receptors in the pituitary gland and triggers growth hormone release and production. Besides promoting growth, it has the additional benefit of reducing scarring following a heart attack, increasing bone density, improving renal function and reducing seizure activity.
IFDA approved Sermorelin in 1997 for the treatment of growth hormone deficiency in children. It was sold under the brand name Geref. Later, FDA withdrew its approval in 2008 because of commercial reasons. Currently, scientists are interested in exploring its effect on sleep, brain tumor and heart health. Right now, sermorelin for sale is available for research purposes only.
From Pubchem
Synonym: Sermorelina, 86168-78-7, SomatoliberinMolecular Formula: C149H246N44O42SMolecular Weight: 3357.9 g/molSequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRCAS Number: 86168-78-7PubChem CID: 16132413
Because of its growth hormone-releasing properties, it can be used in people with this hormone deficiency. In fact, it is preferred over the administration of synthetic growth hormone (GH). It mimics the process by which the human body naturally produces GH in an episodic and intermittent manner rather than constant levels achieved by injecting GH.
Also, sermorelin is subject to the negative feedback mechanism which involves somatostatin, an inhibitor of growth hormone, to prevent unwanted side effects associated with improper dosing. Further, it can avoid tachyphylaxis, loss of drug response after repeated or continued exposure, unlike exogenous GH administration [1].
Levels of growth hormone and GHRH decline with advancing age. Sermorelin can be effectively used to treat growth hormone deficiency in adults. It stimulates the production of IGF-1 in the liver and increases pituitary preserve, thus preserving the hormone neuroendocrine axis and youthful physiology [1].
In a randomized single-blind placebo-controlled trial, participants involving elderly men and women self-injected placebo for 4 weeks followed by GHRH analog administration for sixteen weeks. GHRG analog administration at night resulted in an acute increase in growth hormone within 10 minutes that lasted for up to 2 hours. This effect was sustained during the course of the whole study. Further, researchers observed elevated IGF-1 and IGFBP3 levels, increased skin thickness and lean body mass. However, only men experienced improved insulin sensitivity and libido, suggesting that the treatment has a more pronounced effect on women than men [2].
Research shows that sermorelin can prevent cardiac remodeling and reduce scarring after myocardial infarction. In a study conducted on swine, twenty-five subjects (25 to 30kg) with ischemic cardiomyopathy induced by occlusion of the left descending coronary artery were randomized to either receive a placebo or GHRH analog. The result found that the administration of GHRH analog significantly reduced the size of the infarct and improved diastolic strain. Further, it was suggested that local activation of the GHRH pathway resulted in the repairing process [3].
IResearch shows that sleep loss might be related to cognitive decline associated with age. GHRH analog administration has been shown to improve sleep, which might stem from its beneficial effects on cognition [4].
Further, it was suggested that orexin is important for sleep cycle regulation. Studies indicate that the administration of GHRH analogs, sermorelin, can enhance orexin secretion [5].
Sermorelin was first approved for the treatment of growth hormone deficiency in children in 1997. But later, its sale was withheld. Currently, it has been researched for its effect on the treatment of sleep, myocardial infarction and age-related problems. We don’t support its unwarranted medical use and offer sermorelin purchase only for research and educational institutions. So if you are a researcher looking to explore its potential therapeutic use, buy sermorelin from Element Sarms.
All products on this site are for Research, Development use only. Products are Not for Human consumption of any kind. The statements made within this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure or prevent any disease.